BRENDA::Q3LUE0 has 275 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-13 36.3 0.2 7.5e-13 35.0 0.0 1.7 2 BRENDA::Q3LUE0 Domain annotation for each sequence (and alignments): >> BRENDA::Q3LUE0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.0 0.0 7.5e-13 7.5e-13 11 79 .] 102 170 .. 101 170 .. 0.95 2 ? -2.7 0.1 0.46 0.46 40 53 .. 257 270 .. 247 273 .. 0.68 Alignments for each domain: == domain 1 score: 35.0 bits; conditional E-value: 7.5e-13 CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 ++ ++R+ lak++ +yK ++ ++ d Re++vle + ++ +++g+ ++ e++f++ +++ + +Qk BRENDA::Q3LUE0 102 IVGVANKRLMLAKDVVNYKFHHNTSIDDFVREKQVLESVSAQGQKAGIGGNYGEEFFQDQMDANKMIQK 170 566779***********************************999********************99996 PP == domain 2 score: -2.7 bits; conditional E-value: 0.46 CM_2 40 eReeevlerlrega 53 e e+++++++ e+a BRENDA::Q3LUE0 257 EVEAKIVAQIDEKA 270 55677777776655 PP
Or compare BRENDA::Q3LUE0 to CDD or PaperBLAST