C1C3N3 has 210 amino acids
Query: PDC10_C [M=90]
Accession: PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.4e-44 134.3 1.0 1.3e-43 133.3 1.0 1.5 1 C1C3N3
Domain annotation for each sequence (and alignments):
>> C1C3N3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 133.3 1.0 1.3e-43 1.3e-43 1 90 [] 72 159 .. 72 159 .. 0.98
Alignments for each domain:
== domain 1 score: 133.3 bits; conditional E-value: 1.3e-43
PDC10_C 1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90
vn++eslLr+a++ dveey+ier e efqeln+karaLk+iL +iPdeindR +fL+tik+iAsaik+lLd+vn+v+kk+q+ ++++ale
C1C3N3 72 VNFTESLLRMAAA-DVEEYMIERPEPEFQELNEKARALKQILGKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 159
8************.********************************************************************.8899997 PP
Or compare C1C3N3 to CDD or PaperBLAST