PaperBLAST – Find papers about a protein or its homologs

 

Align C1C3N3 to PF06840 (PDC10_C)

C1C3N3 has 210 amino acids

Query:       PDC10_C  [M=90]
Accession:   PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    6.4e-44  134.3   1.0    1.3e-43  133.3   1.0    1.5  1  C1C3N3    


Domain annotation for each sequence (and alignments):
>> C1C3N3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  133.3   1.0   1.3e-43   1.3e-43       1      90 []      72     159 ..      72     159 .. 0.98

  Alignments for each domain:
  == domain 1  score: 133.3 bits;  conditional E-value: 1.3e-43
  PDC10_C   1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 
              vn++eslLr+a++ dveey+ier e efqeln+karaLk+iL +iPdeindR +fL+tik+iAsaik+lLd+vn+v+kk+q+ ++++ale
   C1C3N3  72 VNFTESLLRMAAA-DVEEYMIERPEPEFQELNEKARALKQILGKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 159
              8************.********************************************************************.8899997 PP



Or compare C1C3N3 to CDD or PaperBLAST