PaperBLAST – Find papers about a protein or its homologs

 

Align C4Q5Z1 to PF06840 (PDC10_C)

C4Q5Z1 has 216 amino acids

Query:       PDC10_C  [M=90]
Accession:   PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    8.8e-23   66.5   0.4      2e-22   65.4   0.0    1.7  2  C4Q5Z1    


Domain annotation for each sequence (and alignments):
>> C4Q5Z1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.0   0.1      0.22      0.22      15      33 ..      35      54 ..      28      56 .. 0.54
   2 !   65.4   0.0     2e-22     2e-22       1      90 []      77     165 ..      77     165 .. 0.94

  Alignments for each domain:
  == domain 1  score: -2.0 bits;  conditional E-value: 0.22
  PDC10_C 15 dveeyiie.rkeeefqelnk 33
             + e+y+++ r +e+f +++k
   C4Q5Z1 35 EKENYALTqRLKEAFYKVEK 54
             45566554144556666665 PP

  == domain 2  score: 65.4 bits;  conditional E-value: 2e-22
  PDC10_C   1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 
              ++++e+ Lr+a+ +++++ +++r+     el+  a++Lk+iLs iPdei dR++f+e ik iA aik lL av + + + +  ++kk le
   C4Q5Z1  77 IDVTETCLRIAALQECDNSRTSRN-PRVLELELTAKTLKTILSSIPDEIIDRRAFIEVIKGIADAIKMLLAAVGAFYDTLPPGTQKKCLE 165
              789**********99988888775.7789***************************************************9999999987 PP



Or compare C4Q5Z1 to CDD or PaperBLAST