C9JXI5 has 227 amino acids
Query: DUF4203 [M=201] Accession: PF13886.10 Description: Domain of unknown function (DUF4203) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-46 144.6 26.3 1.9e-46 144.4 26.3 1.0 1 C9JXI5 Domain annotation for each sequence (and alignments): >> C9JXI5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 144.4 26.3 1.9e-46 1.9e-46 2 192 .. 41 227 .] 40 227 .] 0.91 Alignments for each domain: == domain 1 score: 144.4 bits; conditional E-value: 1.9e-46 DUF4203 2 lgailillGlvycffGyrlfkltlflsgfllgslivlvlilkvmvlpsslvqgaflvaavvaGllgGllallfwelglfllgllgGlllallllslleggli 103 ++++++l+G+vycffGyr+fk++lfl+g+l+gs+++++l+++++vl+++l+ ga++++a+++Gll+Gl+a+l++++glfl+gll+Gllla ++l ++ C9JXI5 41 VCIMCCLFGVVYCFFGYRCFKAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFLVGLLLGLLLAAAALLGS-APYY 141 8******************************************************************************************999999.5666 PP DUF4203 104 tslpakaif...vlivvlalvgavlslslqkyllivstsvvGatavvlgiDyfvgaglkefll.nlfpratvalltypltrgiwvllaaiivl 192 ++ + ++ +l+++ +l++a+l+l+++++l+ ++t+v Ga+++ + Dyf++ l ++ + + + a +pl + +w+lla++++l C9JXI5 142 QPGS---VWgplGLLLGGGLLCALLTLRWPRPLTTLATAVTGAALIATAADYFAELLLLGRYVvERL---R-AAPVPPLCWRSWALLALWPLL 227 6444...44556********************************************97775553333...3.4558**************986 PP
Or compare C9JXI5 to CDD or PaperBLAST