CAZy::AAC64928.1 has 393 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-37 113.0 1.9 5.6e-37 113.0 1.9 1.7 2 CAZy::AAC64928.1 Domain annotation for each sequence (and alignments): >> CAZy::AAC64928.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.1 0.1 0.72 0.72 122 136 .. 163 177 .. 156 178 .. 0.74 2 ! 113.0 1.9 5.6e-37 5.6e-37 4 145 .] 235 378 .. 232 378 .. 0.94 Alignments for each domain: == domain 1 score: -4.1 bits; conditional E-value: 0.72 EryCIII-like_C 122 aaklaeeiaaePsPt 136 a+ a+e++ +P+P+ CAZy::AAC64928.1 163 AGASAREVVIDPCPA 177 556678888888885 PP == domain 2 score: 113.0 bits; conditional E-value: 5.6e-37 EryCIII-like_C 4 ldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 + ++ +l E+v+ ++ + lp +vR v Pl+++lp+c+a+vHhgG+ + l a+ G+Pq+v++d++++ ++a+r+ae+Ga++ l+ CAZy::AAC64928.1 235 MRALPRLGVEVVLVARAEDLARQGGLPAGVRAVTGAPLHAVLPSCTAVVHHGGSNTALGAVVRGLPQLVVSDTFERDLNAQRLAETGAAVHLE 327 677889999*****99***************************************************************************97 PP EryCIII-like_C 97 k..deltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 e+++d +a+av+++v+d y aaa+l+ ++ +PsP+ va eel CAZy::AAC64928.1 328 AreAEADPDAVATAVGRLVDDDRYARAAAELRGLALTRPSPARVAGGFEEL 378 51157899*************************************998886 PP
Or compare CAZy::AAC64928.1 to CDD or PaperBLAST