PaperBLAST – Find papers about a protein or its homologs

 

Align CAZy::AAC64928.1 to PF06722 (EryCIII-like_C)

CAZy::AAC64928.1 has 393 amino acids

Query:       EryCIII-like_C  [M=145]
Accession:   PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------         -----------
    5.6e-37  113.0   1.9    5.6e-37  113.0   1.9    1.7  2  CAZy::AAC64928.1  


Domain annotation for each sequence (and alignments):
>> CAZy::AAC64928.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -4.1   0.1      0.72      0.72     122     136 ..     163     177 ..     156     178 .. 0.74
   2 !  113.0   1.9   5.6e-37   5.6e-37       4     145 .]     235     378 ..     232     378 .. 0.94

  Alignments for each domain:
  == domain 1  score: -4.1 bits;  conditional E-value: 0.72
    EryCIII-like_C 122 aaklaeeiaaePsPt 136
                       a+  a+e++ +P+P+
  CAZy::AAC64928.1 163 AGASAREVVIDPCPA 177
                       556678888888885 PP

  == domain 2  score: 113.0 bits;  conditional E-value: 5.6e-37
    EryCIII-like_C   4 ldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 
                       + ++ +l  E+v+   ++     + lp +vR v   Pl+++lp+c+a+vHhgG+ + l a+  G+Pq+v++d++++ ++a+r+ae+Ga++ l+
  CAZy::AAC64928.1 235 MRALPRLGVEVVLVARAEDLARQGGLPAGVRAVTGAPLHAVLPSCTAVVHHGGSNTALGAVVRGLPQLVVSDTFERDLNAQRLAETGAAVHLE 327
                       677889999*****99***************************************************************************97 PP

    EryCIII-like_C  97 k..deltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145
                           e+++d +a+av+++v+d  y  aaa+l+  ++ +PsP+ va   eel
  CAZy::AAC64928.1 328 AreAEADPDAVATAVGRLVDDDRYARAAAELRGLALTRPSPARVAGGFEEL 378
                       51157899*************************************998886 PP



Or compare CAZy::AAC64928.1 to CDD or PaperBLAST