CAZy::ABL09968.1 has 427 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-51 160.6 0.3 2e-51 159.9 0.3 1.4 1 CAZy::ABL09968.1 Domain annotation for each sequence (and alignments): >> CAZy::ABL09968.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 159.9 0.3 2e-51 2e-51 4 145 .] 280 421 .. 277 421 .. 0.98 Alignments for each domain: == domain 1 score: 159.9 bits; conditional E-value: 2e-51 EryCIII-like_C 4 ldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 +d+va+lDaE+v+ lde r l+ +p n R+vdf Pl+vllptcaaivHhgGag++ ta+ +GvPq++l+ +d+ ra r+ elGag+ l+ CAZy::ABL09968.1 280 FDAVADLDAEVVALLDETDRAALTTVPANTRVVDFTPLHVLLPTCAAIVHHGGAGTWSTAAVHGVPQLLLASMWDNVFRAVRTEELGAGLFLP 372 699****************************************************************************************** PP EryCIII-like_C 97 kdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 + elt++ ++ a+++++++p++ ++a +l++ + ++P+P+ v+++le l CAZy::ABL09968.1 373 PAELTPAALRGALERLLKEPSFADGADHLRRAMTSQPAPHTVVTELERL 421 *********************************************9976 PP
Or compare CAZy::ABL09968.1 to CDD or PaperBLAST