CAZy::CAA63090.1 has 541 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.18 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-20 57.7 0.0 1.2e-19 56.9 0.0 1.3 1 CAZy::CAA63090.1 Domain annotation for each sequence (and alignments): >> CAZy::CAA63090.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.9 0.0 1.2e-19 1.2e-19 7 133 .. 312 437 .. 306 442 .. 0.87 Alignments for each domain: == domain 1 score: 56.9 bits; conditional E-value: 1.2e-19 HHTSSSEEEE---TTTTSS-SS--SSEEE--S--HHHHG..GG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE--T CS EryCIII-like_C 7 lgevDaeivvtldararedlaslPdnvRlvdfvPlgvlL..ptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialpk 97 lg++ + ++ + ++ + ++l +n +l++++P +lL + a++ hGG s + +GvP + +p + D+ rv++ G Gi l+ CAZy::CAA63090.1 312 LGRLPQKVIWRF---SGTKPKNLGNNTKLIEWLPQNDLLghSNIRAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEW 401 556666666664...3444568889**************444678************************************************ PP TT--HHHHHHHHHHHHH-HHHHHHHHHHHHHHHTS- CS EryCIII-like_C 98 deldadslaeavarvledpayreaaaklaeealaeP 133 ++++ +l a+ +v+++p+yr+ a+kl e +P CAZy::CAA63090.1 402 NTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQP 437 ****************************98766666 PP
Or compare CAZy::CAA63090.1 to CDD or PaperBLAST