CAZy::CAC37807.1 has 436 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-53 166.2 0.6 4.4e-53 165.3 0.6 1.5 1 CAZy::CAC37807.1 Domain annotation for each sequence (and alignments): >> CAZy::CAC37807.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 165.3 0.6 4.4e-53 4.4e-53 2 145 .] 273 415 .. 272 415 .. 0.98 Alignments for each domain: == domain 1 score: 165.3 bits; conditional E-value: 4.4e-53 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagiv 94 ++ld++a++DaE v+++d+++ +++++p nvR+++fvP++vllptcaa+vHhgG+gs+lta+++GvPq++l+d ad+ v+a+++++lGag++ CAZy::CAC37807.1 273 EMLDAIADIDAEFVATFDDQQLVGVGSVPANVRTAGFVPMNVLLPTCAATVHHGGTGSWLTAAIHGVPQIILSD-ADTEVHAKQLQDLGAGLS 364 579*********************************************************************97.7***************** PP EryCIII-like_C 95 lskdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 l++ ++t+++++ a+++v+++payr +a+++++ + +PsP+ v+ +++l CAZy::CAC37807.1 365 LPVAGMTAEHLRGAIERVLDEPAYRLGAERMRDGMRTDPSPAQVVGICQDL 415 *********************************************999876 PP
Or compare CAZy::CAC37807.1 to CDD or PaperBLAST