CAZy::CAC37814.1 has 417 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-58 183.5 0.7 1.7e-58 182.9 0.7 1.3 1 CAZy::CAC37814.1 Domain annotation for each sequence (and alignments): >> CAZy::CAC37814.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 182.9 0.7 1.7e-58 1.7e-58 3 145 .] 270 409 .. 268 409 .. 0.98 Alignments for each domain: == domain 1 score: 182.9 bits; conditional E-value: 1.7e-58 EryCIII-like_C 3 vldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivl 95 +l+ +a++D+Eivv+ ++ d +++pdnvRlvdfvP+++llp+caa++HhgGags++tal++GvPq+++++e+d+ +r++r+aelGag+ l CAZy::CAC37814.1 270 TLATLARFDGEIVVT---RSGLDPASVPDNVRLVDFVPMNILLPGCAAVIHHGGAGSWATALHHGVPQISVAHEWDCVLRGQRTAELGAGVFL 359 7999***********...99999********************************************************************** PP EryCIII-like_C 96 skdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 ++de+++d++ +a+a vved+++ ++a+kl++e++a P+P+Ev++ le+l CAZy::CAC37814.1 360 RPDEVDADTLWQALATVVEDRSHAENAEKLRQEALAAPTPAEVVPVLEAL 409 *********************************************99987 PP
Or compare CAZy::CAC37814.1 to CDD or PaperBLAST