CAZy::CAE17535.1 has 393 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-37 114.0 1.9 4.4e-37 113.3 1.9 1.3 1 CAZy::CAE17535.1 Domain annotation for each sequence (and alignments): >> CAZy::CAE17535.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.3 1.9 4.4e-37 4.4e-37 2 144 .. 238 381 .. 237 382 .. 0.97 Alignments for each domain: == domain 1 score: 113.3 bits; conditional E-value: 4.4e-37 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagiv 94 +vld++a lD E vva++ +r+ l+++ + R+v+ +P++ +lp+c+a+vHhgGa+++l+a+ fGvPq+ +p+ +++ +++ + + Gag+ CAZy::CAE17535.1 238 TVLDALAGLDVEPVVAVTGAERELLGDVGGRARIVQDLPIHTVLPSCSAVVHHGGATTVLSAARFGVPQLTMPHLFEQRLNSDLLEAAGAGVQ 330 589****************************************************************************************** PP EryCIII-like_C 95 lskdeltsdsiakavaevv.edpayraaaaklaeeiaaePsPtEvakklee 144 l+ ++++si +av+e++ +d +y a+ l++ei a PsP E + +ee CAZy::CAE17535.1 331 LTAAHADAESIGAAVTELLrGDAPYAVASRGLRDEIEAMPSPLETVALIEE 381 ****************98757999********************9988775 PP
Or compare CAZy::CAE17535.1 to CDD or PaperBLAST