D3YV92 has 440 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-28 84.4 0.4 5.2e-28 83.4 0.4 1.6 1 D3YV92
Domain annotation for each sequence (and alignments):
>> D3YV92
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 83.4 0.4 5.2e-28 5.2e-28 1 70 [. 114 183 .. 114 184 .. 0.97
Alignments for each domain:
== domain 1 score: 83.4 bits; conditional E-value: 5.2e-28
GARIL_Rab2_bd 1 tleltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekd 70
tl+ltr++Pl+fv+lsv++ ++++lk+kl++gRs+yl+L++++ +++++f++w++l+ lL+++ +++k+
D3YV92 114 TLVLTRFIPLQFVTLSVHSAKNMRLKVKLINGRSYYLQLCAPVYKQDIIFSQWVDLIPLLNQEKIKNTKV 183
799************************************************************9999997 PP
Or compare D3YV92 to CDD or PaperBLAST