D3ZIT7 has 1998 amino acids
Query: DUF3677 [M=81] Accession: PF12432.12 Description: Protein of unknown function (DUF3677) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-39 118.5 1.9 2e-38 116.9 1.9 2.0 1 D3ZIT7 Domain annotation for each sequence (and alignments): >> D3ZIT7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 116.9 1.9 2e-38 2e-38 1 81 [] 377 457 .. 377 457 .. 0.99 Alignments for each domain: == domain 1 score: 116.9 bits; conditional E-value: 2e-38 DUF3677 1 llklLsslcgipevrllvasrleiwlqnpKLvreaqelLlslcvncntssekdsevidaLvklrlKtkalinlftacikel 81 ll+lL+++cg++evrll+++rle+wlqnpKL+r+aq+lL+s+c+ncn++ ++d +vi++L+k+rlK k l+n+++ ci+el D3ZIT7 377 LLRLLTATCGYKEVRLLAVQRLEMWLQNPKLTRPAQDLLMSVCMNCNSHGSEDMDVISHLIKIRLKPKVLLNHYMLCIREL 457 79*****************************************************************************98 PP
Or compare D3ZIT7 to CDD or PaperBLAST