D8UA57 has 3315 amino acids
Query: DUF4485 [M=83] Accession: PF14846.11 Description: Domain of unknown function (DUF4485) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-26 76.7 0.9 5.6e-26 76.7 0.9 2.4 2 D8UA57 Domain annotation for each sequence (and alignments): >> D8UA57 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.7 0.9 5.6e-26 5.6e-26 1 83 [] 8 89 .. 8 89 .. 0.97 2 ? 0.3 0.4 0.037 0.037 59 80 .. 2828 2848 .. 2825 2851 .. 0.75 Alignments for each domain: == domain 1 score: 76.7 bits; conditional E-value: 5.6e-26 DUF4485 1 ldeeFeyalekikellaslkskeekeraaeWlkKLceptknveekknRNdYlqlLlemlqegelegPFnkpPpsgpLpplael 83 ld +F+++ ++++ l+ s + + +k r+++Wl+KL+ept+n+++k+nRN+Y+ lLl +lq+g+le PF+++Pp+g+Lp+l+++ D8UA57 8 LDLQFQQTAAQLTILALSQP-RVAKLRVQAWLAKLREPTNNAVWKRNRNMYCALLLAQLQQGQLELPFTTMPPDGALPNLPNH 89 799***************99.66*********************************************************985 PP == domain 2 score: 0.3 bits; conditional E-value: 0.037 DUF4485 59 lqegelegPFnkpPpsgpLppl 80 l+ +++ +PF + Pp+gpLpp D8UA57 2828 LEASQVAAPFMQ-PPDGPLPPP 2848 566788999975.7789**985 PP
Or compare D8UA57 to CDD or PaperBLAST