PaperBLAST – Find papers about a protein or its homologs

 

Align D9Q971 to PF04341 (DUF485)

D9Q971 has 113 amino acids

Query:       DUF485  [M=89]
Accession:   PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.5e-39  119.5   2.3    2.9e-39  119.3   2.3    1.0  1  D9Q971    


Domain annotation for each sequence (and alignments):
>> D9Q971  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  119.3   2.3   2.9e-39   2.9e-39       3      89 .]      24     109 ..      22     109 .. 0.98

  Alignments for each domain:
  == domain 1  score: 119.3 bits;  conditional E-value: 2.9e-39
  DUF485   3 spkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeire 89 
             sp+F+eL+r++r+f+fp++++f+v+Y++fv+++++apd+++tkvv g+i++g++lg+ qfv+tfv+t++Y+++An++++p+a++ire
  D9Q971  24 SPQFKELKRTYRSFTFPMSIAFFVWYLVFVIAATYAPDFMGTKVV-GSINLGVVLGITQFVTTFVITWIYIKYANKNIEPRARAIRE 109
             8********************************************.***************************************96 PP



Or compare D9Q971 to CDD or PaperBLAST