D9Q971 has 113 amino acids
Query: DUF485 [M=88]
Accession: PF04341.17
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-39 120.4 2.2 1.5e-39 120.2 2.2 1.0 1 D9Q971
Domain annotation for each sequence (and alignments):
>> D9Q971
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.2 2.2 1.5e-39 1.5e-39 3 88 .] 24 109 .. 22 109 .. 0.98
Alignments for each domain:
== domain 1 score: 120.2 bits; conditional E-value: 1.5e-39
DUF485 3 spkFqeLvrkrrrfafpltalflvvYflfvlliafapellatkvggnitvgillGllqfvltfvltgiYvrrAnrefDplaeeire 88
sp+F+eL+r++r+f+fp++++f+v+Y++fv+ +++ap++++tkv+g+i++g++lG+ qfv+tfv+t+iY+++An++++p+a++ire
D9Q971 24 SPQFKELKRTYRSFTFPMSIAFFVWYLVFVIAATYAPDFMGTKVVGSINLGVVLGITQFVTTFVITWIYIKYANKNIEPRARAIRE 109
8***********************************************************************************96 PP
Or compare D9Q971 to CDD or PaperBLAST