PaperBLAST – Find papers about a protein or its homologs

 

Align D9S306 to PF04025 (RemA-like)

D9S306 has 89 amino acids

Query:       RemA-like  [M=73]
Accession:   PF04025.16
Description: Extracellular matrix regulatory protein A-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.6e-43  133.0   0.9    1.9e-43  132.8   0.9    1.1  1  D9S306    


Domain annotation for each sequence (and alignments):
>> D9S306  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  132.8   0.9   1.9e-43   1.9e-43       1      73 []       5      77 ..       5      77 .. 0.99

  Alignments for each domain:
  == domain 1  score: 132.8 bits;  conditional E-value: 1.9e-43
  RemA-like  1 liniGfgnvVnadriiaivspdsapikrliqeakeegklidaTqgrktrsviitdsghviLSalqpetlakRl 73
               l+niGfgn+V+a+riiaivsp+sapikr+iqea+++g+lidaT+gr+tr+viitds+hviLSa+qpet+a+Rl
     D9S306  5 LVNIGFGNIVSANRIIAIVSPESAPIKRIIQEARDRGMLIDATYGRRTRAVIITDSDHVILSAVQPETVANRL 77
               79**********************************************************************7 PP



Or compare D9S306 to CDD or PaperBLAST