E1BAR0 has 78 amino acids
Query: SMIM5_18_22 [M=56]
Accession: PF15831.9
Description: Small integral membrane protein 5/18/22
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-28 85.8 6.2 1.2e-28 85.6 6.2 1.0 1 E1BAR0
Domain annotation for each sequence (and alignments):
>> E1BAR0
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 85.6 6.2 1.2e-28 1.2e-28 1 56 [] 8 62 .. 8 62 .. 0.99
Alignments for each domain:
== domain 1 score: 85.6 bits; conditional E-value: 1.2e-28
SMIM5_18_22 1 qelesvlqevllrLqslqpfqsewdiaaFvvlllFigtVllLlllvilycccscCc 56
qe++s+++++ll+Lq+l p++++++i+aF+vl++F++tV+lLll+++ +ccc++C+
E1BAR0 8 QEIHSIGDRLLLKLQRL-PQAEPVEILAFSVLVVFTATVVLLLLIACGFCCCQYCW 62
89***************.*************************************8 PP
Or compare E1BAR0 to CDD or PaperBLAST