E1BHN4 has 5005 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-22 65.0 2.6 6.6e-22 63.3 2.6 2.0 1 E1BHN4
Domain annotation for each sequence (and alignments):
>> E1BHN4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 63.3 2.6 6.6e-22 6.6e-22 8 53 .. 4302 4347 .. 4293 4348 .. 0.90
Alignments for each domain:
== domain 1 score: 63.3 bits; conditional E-value: 6.6e-22
ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53
+wY+CpnGH++ +geCG++m++s C +C+a+IGG +h +++g++
E1BHN4 4302 GVTWYTCPNGHVCSVGECGKPMQQSFCIDCRAPIGGINHLPKEGFR 4347
589*************************************999986 PP
Or compare E1BHN4 to CDD or PaperBLAST