E5RGR5 has 45 amino acids
Query: DUF4665 [M=99]
Accession: PF15679.9
Description: Domain of unknown function (DUF4665)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-23 70.0 7.3 1.2e-23 69.9 7.3 1.0 1 E5RGR5
Domain annotation for each sequence (and alignments):
>> E5RGR5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.9 7.3 1.2e-23 1.2e-23 1 45 [. 1 45 [] 1 45 [] 0.98
Alignments for each domain:
== domain 1 score: 69.9 bits; conditional E-value: 1.2e-23
DUF4665 1 MgKnKqkgkkqknVFkvAsakslKaKaKAkpVttnLKkinavkke 45
M+KnK +g k++nVF++As+k++KaK+KAkpVttnLKkin++++e
E5RGR5 1 MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEE 45
9*****************************************986 PP
Or compare E5RGR5 to CDD or PaperBLAST