E7F8X0 has 460 amino acids
Query: DUF4174 [M=120] Accession: PF13778.10 Description: Domain of unknown function (DUF4174) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-39 121.6 0.0 1.9e-39 121.0 0.0 1.3 1 E7F8X0 Domain annotation for each sequence (and alignments): >> E7F8X0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 121.0 0.0 1.9e-39 1.9e-39 2 120 .] 330 448 .. 329 448 .. 0.99 Alignments for each domain: == domain 1 score: 121.0 bits; conditional E-value: 1.9e-39 DUF4174 2 LasfkwkrRlLiisapseddarlkqqrealqaaecelaeRdllvielvgsgaketgkieeeqlsselieeLrkelkiskekfsmvLigkdggvkeryeapvs 103 L++f++krRlL++s+p++ +++++ q+ +lq+a c+l+ R+++viel+gs ++ +g+i+e++l++e ie+Lr++l+is +f+mvL++ g ++er+ +p++ E7F8X0 330 LDQFYEKRRLLVVSTPDNGNQKYRLQNMMLQKAGCGLDLRHVTVIELLGSPPRAVGRIKEQRLQPEVIEDLRQALHISMAYFTMVLLDDYGVDRERFVNPTN 431 9***************************************************************************************************** PP DUF4174 104 leelfdlIDampmRqqE 120 eelf+++D++ + ++E E7F8X0 432 SEELFSYVDEFLLTEEE 448 ***********999887 PP
Or compare E7F8X0 to CDD or PaperBLAST