E9Q555 has 5148 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.1e-23 66.8 2.3 2.3e-22 64.7 2.3 2.2 1 E9Q555
Domain annotation for each sequence (and alignments):
>> E9Q555
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 64.7 2.3 2.3e-22 2.3e-22 8 53 .. 4445 4490 .. 4436 4491 .. 0.91
Alignments for each domain:
== domain 1 score: 64.7 bits; conditional E-value: 2.3e-22
ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53
+ +wY+Cp+GHp+ +geCGr+m+es+C +Cg ++GG +h++++g++
E9Q555 4445 NVTWYTCPRGHPCSVGECGRPMQESTCLDCGLPVGGLNHTPHEGFS 4490
689***************************************9986 PP
Or compare E9Q555 to CDD or PaperBLAST