PaperBLAST – Find papers about a protein or its homologs

 

Align ENA::BAB91152.1 to PF04167 (DUF402)

ENA::BAB91152.1 has 472 amino acids

Query:       DUF402  [M=68]
Accession:   PF04167.17
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------        -----------
    1.5e-20   59.5   3.7    1.5e-20   59.5   3.7    2.9  3  ENA::BAB91152.1  


Domain annotation for each sequence (and alignments):
>> ENA::BAB91152.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.1     0.018     0.018      44      54 ..      49      59 ..      38      71 .. 0.71
   2 ?   -1.4   0.0      0.15      0.15       7      33 ..      86     115 ..      80     123 .. 0.63
   3 !   59.5   3.7   1.5e-20   1.5e-20       1      68 []     377     444 ..     377     444 .. 0.96

  Alignments for each domain:
  == domain 1  score: 1.5 bits;  conditional E-value: 0.018
           DUF402 44 kyiDlyLDvvv 54
                      y+D+++D+  
  ENA::BAB91152.1 49 SYEDFDVDIYD 59
                     79******974 PP

  == domain 2  score: -1.4 bits;  conditional E-value: 0.15
           DUF402   7 lplgewynvtkflde...dgrlkgwYvnia 33 
                      ++++++y+ +  +++   +++++ +Yv+i+
  ENA::BAB91152.1  86 FFRKLPYKLHGIYKGlvvKRDDRFVYVDIG 115
                      666666666666665432335666788886 PP

  == domain 3  score: 59.5 bits;  conditional E-value: 1.5e-20
           DUF402   1 dlalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 
                      d+a++ +  g+w+ v++++d+dg+lkg   ni+tp e+++++ +y+Dl++D+v++pdg+ e++D + L
  ENA::BAB91152.1 377 DYAITEIEAGKWWFVHRYYDKDGNLKGEFYNINTPVEIYPDKARYVDLEVDIVRWPDGKKEIIDKEKL 444
                      6889999*******************************9999**********************9865 PP



Or compare ENA::BAB91152.1 to CDD or PaperBLAST