ENA::CAA68901.1 has 210 amino acids
Query: DUF1648 [M=49]
Accession: PF07853.15
Description: Domain of unknown function (DUF1648)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-25 74.8 0.2 1.7e-25 74.8 0.2 2.6 2 ENA::CAA68901.1
Domain annotation for each sequence (and alignments):
>> ENA::CAA68901.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.8 0.2 1.7e-25 1.7e-25 1 49 [] 13 61 .. 13 61 .. 0.98
2 ? -1.8 0.6 0.14 0.14 1 8 [. 193 200 .. 186 206 .. 0.57
Alignments for each domain:
== domain 1 score: 74.8 bits; conditional E-value: 1.7e-25
DUF1648 1 llillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49
l++llp+v+gl+l+ +LP+qi+tHf++sG+pDgy+sK+ ++f+lP+++l
ENA::CAA68901.1 13 LIVLLPIVIGLLLWRQLPEQIATHFDFSGKPDGYSSKFEAVFFLPGVML 61
799********************************************96 PP
== domain 2 score: -1.8 bits; conditional E-value: 0.14
DUF1648 1 llillplv 8
+++++p++
ENA::CAA68901.1 193 VILVVPMI 200
34455555 PP
Or compare ENA::CAA68901.1 to CDD or PaperBLAST