PaperBLAST – Find papers about a protein or its homologs

 

Align F1M0R1 to PF20173 (ZnF_RZ-type)

F1M0R1 has 5126 amino acids

Query:       ZnF_RZ-type  [M=54]
Accession:   PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.6e-23   67.8   1.2    2.6e-23   67.8   1.2    2.4  2  F1M0R1    


Domain annotation for each sequence (and alignments):
>> F1M0R1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.2   0.1      0.18      0.18      37      50 ..    2453    2466 ..    2441    2469 .. 0.76
   2 !   67.8   1.2   2.6e-23   2.6e-23       8      51 ..    4423    4466 ..    4415    4469 .. 0.91

  Alignments for each domain:
  == domain 1  score: -2.2 bits;  conditional E-value: 0.18
  ZnF_RZ-type   37 CgatIGGeshnlaa 50  
                   C +t+GGe+ n  +
       F1M0R1 2453 CDRTVGGEHLNEDS 2466
                   *******9877655 PP

  == domain 2  score: 67.8 bits;  conditional E-value: 2.6e-23
  ZnF_RZ-type    8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaag 51  
                   + +wY+CpnGHp+ +geCG++me+s Cp+C+ +IGG +h++  g
       F1M0R1 4423 NVRWYTCPNGHPCSVGECGQPMEMSICPDCRVPIGGLNHKPSVG 4466
                   689*************************************9876 PP



Or compare F1M0R1 to CDD or PaperBLAST