F1RQD7 has 593 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.6e-34 102.5 0.2 9e-34 101.8 0.2 1.3 1 F1RQD7
Domain annotation for each sequence (and alignments):
>> F1RQD7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 101.8 0.2 9e-34 9e-34 1 70 [. 120 189 .. 120 190 .. 0.97
Alignments for each domain:
== domain 1 score: 101.8 bits; conditional E-value: 9e-34
GARIL_Rab2_bd 1 tleltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttekd 70
tleltrllPlkfvk+s++d+ekq+l+lkl+tgR+fyl+L++s+d++e+lf +w++lv+lLr+p+++ +++
F1RQD7 120 TLELTRLLPLKFVKISIHDREKQQLRLKLATGRTFYLQLCPSSDAREDLFCYWEKLVYLLRPPVESCSST 189
79**************************************************************988776 PP
Or compare F1RQD7 to CDD or PaperBLAST