PaperBLAST – Find papers about a protein or its homologs

 

Align F7G2J3 to PF16297 (DUF4939)

F7G2J3 has 1359 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.2e-19   55.7   0.0    5.3e-19   54.4   0.0    1.6  1  F7G2J3    


Domain annotation for each sequence (and alignments):
>> F7G2J3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   54.4   0.0   5.3e-19   5.3e-19      21     105 ..     197     281 ..     182     285 .. 0.93

  Alignments for each domain:
  == domain 1  score: 54.4 bits;  conditional E-value: 5.3e-19
  DUF4939  21 wrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefGw 105
                  +p p++f+G+   + efiv     +    + f++d+l+v ++i +l+G alew+   +q++spl++++ afl+ m e+f +
   F7G2J3 197 NAGQLPAPKHFSGDRREFHEFIVLCQLTLQSYPRMFCNDRLRVGYVINHLSGLALEWAKALLQENSPLMGDFPAFLEAMSEVFEY 281
              556789*******************9999999**************************************************987 PP



Or compare F7G2J3 to CDD or PaperBLAST