G3XCW5 has 73 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-26 77.6 0.3 3.1e-26 77.4 0.3 1.1 1 G3XCW5
Domain annotation for each sequence (and alignments):
>> G3XCW5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.4 0.3 3.1e-26 3.1e-26 1 49 [] 24 72 .. 24 72 .. 0.98
Alignments for each domain:
== domain 1 score: 77.4 bits; conditional E-value: 3.1e-26
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49
p+vit++DG++i+++++P +D+d+G+ye+e+++Gk+ ++nkd+V+++ke
G3XCW5 24 PTVITLNDGREIQAVDTPSYDEDSGFYEFEQLDGKRARVNKDQVRTVKE 72
68*********************************************98 PP
Or compare G3XCW5 to CDD or PaperBLAST