H0XA12 has 212 amino acids
Query: PDC10_C [M=90]
Accession: PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.2e-44 134.6 1.6 1.1e-43 133.6 1.6 1.5 1 H0XA12
Domain annotation for each sequence (and alignments):
>> H0XA12
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 133.6 1.6 1.1e-43 1.1e-43 1 90 [] 74 161 .. 74 161 .. 0.98
Alignments for each domain:
== domain 1 score: 133.6 bits; conditional E-value: 1.1e-43
PDC10_C 1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90
+n++eslLr+a++ dveey+ier e efq+ln+karaLk+iLs+iPdei+dR +fL+tik+iAsaik+lLd+vn+v+kk+q+ ++++ale
H0XA12 74 INFTESLLRMAAD-DVEEYMIERPEPEFQDLNEKARALKQILSKIPDEISDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 161
89***********.********************************************************************.8899997 PP
Or compare H0XA12 to CDD or PaperBLAST