H2KTN8 has 216 amino acids
Query: PDC10_C [M=90] Accession: PF06840.15 Description: Programmed cell death protein 10, C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-24 70.2 0.6 1.6e-23 68.9 0.2 1.8 2 H2KTN8 Domain annotation for each sequence (and alignments): >> H2KTN8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.19 0.19 21 34 .. 42 55 .. 31 61 .. 0.58 2 ! 68.9 0.2 1.6e-23 1.6e-23 1 90 [] 77 165 .. 77 165 .. 0.90 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.19 PDC10_C 21 ierkeeefqelnkk 34 ++r +e+f +++k+ H2KTN8 42 TKRLKEAFSKVEKR 55 34445566666665 PP == domain 2 score: 68.9 bits; conditional E-value: 1.6e-23 PDC10_C 1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 v+l+e Lrlag ++ + + e++ ka+ Lk+ Ls+iPd+i+dR++f+e ik iA aik++Ldav +v+ q++++++al+ H2KTN8 77 VDLSELSLRLAGFQE-GGVHRSSRRPYLSEIEAKAQVLKASLSTIPDKISDRRSFIELIKVIANAIKQVLDAVTQVLDALQHSTQRQALD 165 7899999*****955.3444444556889***********************************************************97 PP
Or compare H2KTN8 to CDD or PaperBLAST