PaperBLAST – Find papers about a protein or its homologs

 

Align H2KTN8 to PF06840 (PDC10_C)

H2KTN8 has 216 amino acids

Query:       PDC10_C  [M=90]
Accession:   PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    6.5e-24   70.2   0.6    1.6e-23   68.9   0.2    1.8  2  H2KTN8    


Domain annotation for each sequence (and alignments):
>> H2KTN8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.8   0.0      0.19      0.19      21      34 ..      42      55 ..      31      61 .. 0.58
   2 !   68.9   0.2   1.6e-23   1.6e-23       1      90 []      77     165 ..      77     165 .. 0.90

  Alignments for each domain:
  == domain 1  score: -1.8 bits;  conditional E-value: 0.19
  PDC10_C 21 ierkeeefqelnkk 34
             ++r +e+f +++k+
   H2KTN8 42 TKRLKEAFSKVEKR 55
             34445566666665 PP

  == domain 2  score: 68.9 bits;  conditional E-value: 1.6e-23
  PDC10_C   1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 
              v+l+e  Lrlag ++      + +     e++ ka+ Lk+ Ls+iPd+i+dR++f+e ik iA aik++Ldav +v+   q++++++al+
   H2KTN8  77 VDLSELSLRLAGFQE-GGVHRSSRRPYLSEIEAKAQVLKASLSTIPDKISDRRSFIELIKVIANAIKQVLDAVTQVLDALQHSTQRQALD 165
              7899999*****955.3444444556889***********************************************************97 PP



Or compare H2KTN8 to CDD or PaperBLAST