H7C6X1 has 364 amino acids
Query: PDH_N [M=154] Accession: PF02153.21 Description: Prephenate dehydrogenase, nucleotide-binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-43 131.6 0.0 1.3e-42 131.1 0.0 1.2 1 H7C6X1 Domain annotation for each sequence (and alignments): >> H7C6X1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 131.1 0.0 1.3e-42 1.3e-42 1 153 [. 17 169 .. 17 170 .. 0.97 Alignments for each domain: == domain 1 score: 131.1 bits; conditional E-value: 1.3e-42 PDH_N 1 laralrrkgfkvtvigydideekakaalelglvdeatdd.ieavkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvggh 102 la+ +++ +++ +ig d+++e+ + a++ gl+de +++ + ++ a+i++l++Pv+++l l+el + e+alitDvgs+K+++ + + kl k+f+ggh H7C6X1 17 LALCIKKGHPNSEIIGFDNQAEATEFAKKTGLIDEIAESlTSGARRAEIIFLCSPVKATLVQLEELNQLSLETALITDVGSTKVEINQLATKLNM-KNFIGGH 118 6899***********************************99***************************77799*************998888877.******* PP PDH_N 103 PmaGteksGvdaareelfenavviLtPtektdkealelvkelleevgarvi 153 PmaG++ksGv aa e lfena +i t+++ + +++++ ++ ll+++ a++i H7C6X1 119 PMAGSHKSGVTAADERLFENAYYIFTDDHGEKNKQIQELQTLLKGTHAKFI 169 ************************************************997 PP
Or compare H7C6X1 to CDD or PaperBLAST