H9C180 has 116 amino acids
Query: DUF1870 [M=118] Accession: PF08965.14 Description: Domain of unknown function (DUF1870) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-30 89.9 0.0 7.5e-30 89.8 0.0 1.0 1 H9C180 Domain annotation for each sequence (and alignments): >> H9C180 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.8 0.0 7.5e-30 7.5e-30 1 114 [. 1 112 [. 1 116 [] 0.94 Alignments for each domain: == domain 1 score: 89.8 bits; conditional E-value: 7.5e-30 DUF1870 1 mnaveLqalRkilaltieeaatyiaqavdsatWksWesgklaipdeieaelkklkqrrkklleeiveklnerignntlryysdltafltvypegnfleWkiy 102 m + eLqa+Rk l+l++ eaa++i++ v+ +W+ Wesg a+pd +e+e+ +l + r +++ +i ++l + lr+y +l ++l + p+ n + W++ H9C180 1 MTNKELQAIRKLLMLDVSEAAEHIGR-VSARSWQYWESGRSAVPDDVEQEMLDLASVRIEMMSAIDKRLADGE-RPKLRFYNKLDEYLADNPDHNVIGWRLS 100 8899*******************986.8999*********************************999999987.789************************* PP DUF1870 103 qsvaaeLfaedl 114 qsvaa ++e+ H9C180 101 QSVAALYYTEGH 112 ****99998875 PP
Or compare H9C180 to CDD or PaperBLAST