I3L3M7 has 80 amino acids
Query: TXD17-like_Trx [M=119]
Accession: PF06110.15
Description: Thioredoxin domain-containing protein 17-like, thioredoxin domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-30 91.8 0.2 1.4e-30 91.7 0.2 1.0 1 I3L3M7
Domain annotation for each sequence (and alignments):
>> I3L3M7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.7 0.2 1.4e-30 1.4e-30 2 73 .. 9 78 .. 8 80 .] 0.95
Alignments for each domain:
== domain 1 score: 91.7 bits; conditional E-value: 1.4e-30
TXD17-like_Trx 2 vkgfeefekkvkelekesktvfilFsgekdteGesWCPdCvkaepvieealkeapedvklvvvdvGdrevWk 73
v gfeef+++v++ ++ kt+f++F+g+kd G+sWCPdCv+aepv++e+lk+++e +++++++vG++++ k
I3L3M7 9 VSGFEEFHRAVEQ--HNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYLK 78
789********99..7789**************************************************976 PP
Or compare I3L3M7 to CDD or PaperBLAST