J9VQL2 has 864 amino acids
Query: DUF202 [M=68]
Accession: PF02656.19
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-17 49.5 0.9 5e-17 48.5 0.9 1.5 1 J9VQL2
Domain annotation for each sequence (and alignments):
>> J9VQL2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 48.5 0.9 5e-17 5e-17 1 67 [. 762 826 .. 762 827 .. 0.90
Alignments for each domain:
== domain 1 score: 48.5 bits; conditional E-value: 5e-17
DUF202 1 rdglAnERTfLaWlRtslalialgvallrffleggptalalilglilivlgiltlllalvrylrrer 67
++++A+ERTfL+W +++++l a++++ll+f + + a++++ + +++++++ ++l++ +y +r r
J9VQL2 762 KVVFAAERTFLKWAHFAILLSAVSIGLLNFIDPTD--AVGMVSAGCFTFTSLSAILYCGGMYAWRIR 826
689**************************955555..4559***********************988 PP
Or compare J9VQL2 to CDD or PaperBLAST