K7EJ46 has 83 amino acids
Query: SMIM5_18_22 [M=56]
Accession: PF15831.9
Description: Small integral membrane protein 5/18/22
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.9e-31 93.3 6.5 5.8e-31 93.0 6.5 1.1 1 K7EJ46
Domain annotation for each sequence (and alignments):
>> K7EJ46
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 93.0 6.5 5.8e-31 5.8e-31 1 53 [. 6 58 .. 6 60 .. 0.97
Alignments for each domain:
== domain 1 score: 93.0 bits; conditional E-value: 5.8e-31
SMIM5_18_22 1 qelesvlqevllrLqslqpfqsewdiaaFvvlllFigtVllLlllvilycccs 53
+ele+++qevl+rL+s+q+fqs+wd++aF+v+l+F+gtVllLlllv+++ccc+
K7EJ46 6 EELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCC 58
79************************************************998 PP
Or compare K7EJ46 to CDD or PaperBLAST