PaperBLAST – Find papers about a protein or its homologs

 

Align K7S1Q8 to PF09922 (LiaF-like_C)

K7S1Q8 has 216 amino acids

Query:       LiaF-like_C  [M=114]
Accession:   PF09922.13
Description: Cell wall-active antibiotics response LiaF, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      3e-15   42.4   0.7      4e-14   38.8   0.7    2.1  2  K7S1Q8    


Domain annotation for each sequence (and alignments):
>> K7S1Q8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.8   0.7     4e-14     4e-14       2      75 ..     101     174 ..     100     199 .. 0.90
   2 ?    0.6   0.0     0.028     0.028      47      62 ..     193     208 ..     189     216 .] 0.76

  Alignments for each domain:
  == domain 1  score: 38.8 bits;  conditional E-value: 4e-14
  LiaF-like_C   2 iGdqklgkepyelediniqrviGdttiDLskavlpkgetvivirkliGdvkilVPedvevsveasvifGsvtvl 75 
                  +Gd++ g  +     +++ +++Gd+ +DL+ + l  ++ +i i++++Gd+ki+VPe++ v  ++  ++G+ ++ 
       K7S1Q8 101 LGDVTRGAGHTLAARTEVVSGLGDIRLDLTSMELAAHDVIIDIKSVMGDIKIMVPEGIRVIDQTGRFLGDSKFD 174
                  677777788888889999******************************************99999999998865 PP

  == domain 2  score: 0.6 bits;  conditional E-value: 0.028
  LiaF-like_C  47 liGdvkilVPedvevs 62 
                  ++Gdvk++ Pe+v++ 
       K7S1Q8 193 VMGDVKVYGPEHVSFG 208
                  6899999999998875 PP



Or compare K7S1Q8 to CDD or PaperBLAST