M3X793 has 669 amino acids
Query: DUF5009 [M=260] Accession: PF16401.9 Description: Domain of unknown function (DUF5009) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-11 29.4 1.9 3.1e-10 26.0 0.6 2.6 2 M3X793 Domain annotation for each sequence (and alignments): >> M3X793 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 1.5 0.0 0.0095 0.0095 3 18 .. 275 290 .. 273 294 .. 0.86 2 ! 26.0 0.6 3.1e-10 3.1e-10 48 105 .. 307 364 .. 298 402 .. 0.91 Alignments for each domain: == domain 1 score: 1.5 bits; conditional E-value: 0.0095 DUF5009 3 ksldalrGiaillmvl 18 +++d++rGia++lmv+ M3X793 275 RCVDTFRGIALILMVF 290 679***********97 PP == domain 2 score: 26.0 bits; conditional E-value: 3.1e-10 DUF5009 48 pGitwvdlvfpfflfamGaaiplalkkkvekgssklkvlldiikrfvlltffalftmh 105 G+t dlvfp+f+f mG++i l+++ ++g sklk++ +i r ll+ +f+ M3X793 307 NGLTVADLVFPWFVFIMGSSIFLSMTSILQRGCSKLKLMGKIGWRSFLLICIGMFIVN 364 699***********************************************99999875 PP
Or compare M3X793 to CDD or PaperBLAST