NP_001019969.2 has 1105 amino acids
Query: UBAP2-Lig [M=33] Accession: PF12478.13 Description: UBAP2/protein lingerer Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-20 58.8 0.2 5.5e-20 57.5 0.2 1.7 1 NP_001019969.2 Domain annotation for each sequence (and alignments): >> NP_001019969.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.5 0.2 5.5e-20 5.5e-20 2 33 .] 515 546 .. 515 546 .. 0.97 Alignments for each domain: == domain 1 score: 57.5 bits; conditional E-value: 5.5e-20 UBAP2-Lig 2 pSkIPasAVEMPgdanissLDVQFGaldFGse 33 +SkIPa AVEMPg+a+is+L++QFGal+FGse NP_001019969.2 515 TSKIPALAVEMPGSADISGLNLQFGALQFGSE 546 5******************************8 PP
Or compare NP_001019969.2 to CDD or PaperBLAST