PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001035701.1 to PF16297 (DUF4939)

NP_001035701.1 has 376 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    9.3e-19   53.7   0.0    2.3e-18   52.4   0.0    1.6  1  NP_001035701.1  


Domain annotation for each sequence (and alignments):
>> NP_001035701.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   52.4   0.0   2.3e-18   2.3e-18      27     103 ..     137     213 ..     129     220 .. 0.96

  Alignments for each domain:
  == domain 1  score: 52.4 bits;  conditional E-value: 2.3e-18
         DUF4939  27 fpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeef 103
                      pe+fdG+ + l  f+ q   +m    + fs d+++v f+ ++l Gra +w+   +q+ ++l+ ny af+ e+k++f
  NP_001035701.1 137 LPEKFDGNPDMLGPFMYQCQLFMEKSTRDFSVDRIRVCFVTSMLIGRAARWATAKLQRCTYLMHNYTAFMMELKHVF 213
                     69*************************************************************************99 PP



Or compare NP_001035701.1 to CDD or PaperBLAST