NP_001076535.1 has 1144 amino acids
Query: UBAP2-Lig [M=33]
Accession: PF12478.12
Description: UBAP2/protein lingerer
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-19 56.6 0.1 2.8e-19 55.3 0.1 1.8 1 NP_001076535.1
Domain annotation for each sequence (and alignments):
>> NP_001076535.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 55.3 0.1 2.8e-19 2.8e-19 3 33 .] 535 565 .. 534 565 .. 0.97
Alignments for each domain:
== domain 1 score: 55.3 bits; conditional E-value: 2.8e-19
UBAP2-Lig 3 SkIPasAVEMPgdanissLDVQFGaldFGse 33
+kIPa AVEMPg+a+is+L++QFGal+FGse
NP_001076535.1 535 TKIPALAVEMPGSADISGLNLQFGALQFGSE 565
8*****************************8 PP
Or compare NP_001076535.1 to CDD or PaperBLAST