NP_001100031.1 has 171 amino acids
Query: Cg6151-P [M=113]
Accession: PF10233.13
Description: Uncharacterized conserved protein CG6151-P
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-34 103.9 6.8 3.9e-34 103.6 6.8 1.1 1 NP_001100031.1
Domain annotation for each sequence (and alignments):
>> NP_001100031.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 103.6 6.8 3.9e-34 3.9e-34 2 113 .] 34 142 .. 33 142 .. 0.97
Alignments for each domain:
== domain 1 score: 103.6 bits; conditional E-value: 3.9e-34
Cg6151-P 2 GilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatslivaav 96
G+l+++ c + G++n +t+++++i++++++++++f++l++E+P+++++++++++++e ++++ + w++a++Y++ma+v+ +++ +++++++++
NP_001100031.1 34 GVLGAVSCAISGLFNCVTIHPLNIAAGVWMIMNAFILLLCEAPFCCQFVEFANTVAEKVDRL-RSWQKAVFYCGMAIVP-IVMS-LTLTTLLGNA 125
9**************99*********************************************.****************.6666.79******** PP
Cg6151-P 97 lllitavlYglaalkkq 113
++++t+vlYgl al+k+
NP_001100031.1 126 IAFATGVLYGLSALGKK 142
**************997 PP
Or compare NP_001100031.1 to CDD or PaperBLAST