PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001120792.1 to PF12478 (UBAP2-Lig)

NP_001120792.1 has 983 amino acids

Query:       UBAP2-Lig  [M=33]
Accession:   PF12478.12
Description: UBAP2/protein lingerer
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.2e-20   58.8   0.2    4.8e-20   57.7   0.2    1.6  1  NP_001120792.1  


Domain annotation for each sequence (and alignments):
>> NP_001120792.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.7   0.2   4.8e-20   4.8e-20       2      33 .]     495     526 ..     495     526 .. 0.97

  Alignments for each domain:
  == domain 1  score: 57.7 bits;  conditional E-value: 4.8e-20
       UBAP2-Lig   2 pSkIPasAVEMPgdanissLDVQFGaldFGse 33 
                     +SkIPa AVEMPg+a+is+L++QFGal+FGse
  NP_001120792.1 495 TSKIPALAVEMPGSADISGLNLQFGALQFGSE 526
                     5******************************8 PP



Or compare NP_001120792.1 to CDD or PaperBLAST