PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001127830.4 to PF16297 (DUF4939)

NP_001127830.4 has 1357 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.9e-17   48.1   0.0    9.9e-17   47.1   0.0    1.4  1  NP_001127830.4  


Domain annotation for each sequence (and alignments):
>> NP_001127830.4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   47.1   0.0   9.9e-17   9.9e-17      13     105 ..     179     271 ..     168     275 .. 0.92

  Alignments for each domain:
  == domain 1  score: 47.1 bits;  conditional E-value: 9.9e-17
         DUF4939  13 rarlrkrrwrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefGw 105
                      a l k++ +  +p p +f+G+     efiv     +      + sd+l+v +++++l+G alew+   ++k+spl++++ afl+ m ++f +
  NP_001127830.4 179 EAVLAKGLHEGRMPIPATFSGDRREYHEFIVLCQLILQSYPGMYYSDRLRVGYVMCHLSGMALEWAKDLMEKNSPLVSDFPAFLEAMSDMFEY 271
                     556678899999*******************99999999999***********************************************9977 PP



Or compare NP_001127830.4 to CDD or PaperBLAST