PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001128360.1 to PF16297 (DUF4939)

NP_001128360.1 has 1358 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-18   52.7   0.0    4.7e-18   51.4   0.0    1.6  1  NP_001128360.1  


Domain annotation for each sequence (and alignments):
>> NP_001128360.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   51.4   0.0   4.7e-18   4.7e-18      21     105 ..     196     280 ..     181     283 .. 0.93

  Alignments for each domain:
  == domain 1  score: 51.4 bits;  conditional E-value: 4.7e-18
         DUF4939  21 wrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefGw 105
                         +p p++f+G+   + efiv     +    + f +d+l+v ++i +l+G alew+   +q++spl++++ afl+ m e+f +
  NP_001128360.1 196 NAGQLPAPKHFSGDRREFHEFIVLCQLTLQSYPRMFYNDRLRVGYVINHLSGLALEWAKALLQENSPLIGDFPAFLEAMSEVFEY 280
                     556789*******************9999999**************************************************987 PP



Or compare NP_001128360.1 to CDD or PaperBLAST