PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001129045.1 to PF14990 (DUF4516)

NP_001129045.1 has 65 amino acids

Query:       DUF4516  [M=46]
Accession:   PF14990.11
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.5e-30   89.4   1.4    5.2e-30   89.2   1.4    1.1  1  NP_001129045.1  


Domain annotation for each sequence (and alignments):
>> NP_001129045.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   89.2   1.4   5.2e-30   5.2e-30       1      46 []       1      46 [.       1      46 [. 0.98

  Alignments for each domain:
  == domain 1  score: 89.2 bits;  conditional E-value: 5.2e-30
         DUF4516  1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekkee 46
                    mPaGvsw +Yl++++asvlSM+aGAqvVH+yY+Pdl+ip+i++k++
  NP_001129045.1  1 MPAGVSWPRYLRMFAASVLSMFAGAQVVHHYYRPDLSIPEIPPKPG 46
                    9******************************************985 PP



Or compare NP_001129045.1 to CDD or PaperBLAST