NP_001129045.1 has 65 amino acids
Query: DUF4516 [M=46]
Accession: PF14990.10
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.5e-30 89.4 1.4 5.2e-30 89.2 1.4 1.1 1 NP_001129045.1
Domain annotation for each sequence (and alignments):
>> NP_001129045.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.2 1.4 5.2e-30 5.2e-30 1 46 [] 1 46 [. 1 46 [. 0.98
Alignments for each domain:
== domain 1 score: 89.2 bits; conditional E-value: 5.2e-30
DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekkee 46
mPaGvsw +Yl++++asvlSM+aGAqvVH+yY+Pdl+ip+i++k++
NP_001129045.1 1 MPAGVSWPRYLRMFAASVLSMFAGAQVVHHYYRPDLSIPEIPPKPG 46
9******************************************985 PP
Or compare NP_001129045.1 to CDD or PaperBLAST