NP_001138874.1 has 922 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.5e-28 83.3 0.0 1.3e-27 82.1 0.0 1.7 1 NP_001138874.1
Domain annotation for each sequence (and alignments):
>> NP_001138874.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.1 0.0 1.3e-27 1.3e-27 2 69 .. 98 165 .. 97 167 .. 0.97
Alignments for each domain:
== domain 1 score: 82.1 bits; conditional E-value: 1.3e-27
GARIL_Rab2_bd 2 leltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplsttek 69
l+ltr++Pl++v+l+v+d ++++lkl+lv+gR++yl L ++++e+ +lf++w+rl++lL++p +t++
NP_001138874.1 98 LVLTRMIPLDLVHLCVHDLSAWRLKLRLVSGRQYYLALDAPDNEVGFLFHCWVRLINLLQEPAPTWTP 165
79****************************************************************97 PP
Or compare NP_001138874.1 to CDD or PaperBLAST