NP_001138902.1 has 67 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-28 83.0 0.1 5.2e-28 82.9 0.1 1.0 1 NP_001138902.1
Domain annotation for each sequence (and alignments):
>> NP_001138902.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.9 0.1 5.2e-28 5.2e-28 2 57 .] 3 58 .. 2 58 .. 0.97
Alignments for each domain:
== domain 1 score: 82.9 bits; conditional E-value: 5.2e-28
DUF4538 2 rglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
r ++ +++gGf +++g+A+YPI+++P+l peeYk++Q inragi qe+iqP+g+k
NP_001138902.1 3 RLFRTLVIFGGFAAVVGAAFYPIYFRPLLLPEEYKREQSINRAGIVQENIQPPGLK 58
7889**************************************************97 PP
Or compare NP_001138902.1 to CDD or PaperBLAST