PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001138902.1 to PF15061 (DUF4538)

NP_001138902.1 has 67 amino acids

Query:       DUF4538  [M=57]
Accession:   PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.7e-28   83.0   0.1    5.2e-28   82.9   0.1    1.0  1  NP_001138902.1  


Domain annotation for each sequence (and alignments):
>> NP_001138902.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.9   0.1   5.2e-28   5.2e-28       2      57 .]       3      58 ..       2      58 .. 0.97

  Alignments for each domain:
  == domain 1  score: 82.9 bits;  conditional E-value: 5.2e-28
         DUF4538  2 rglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
                    r  ++ +++gGf +++g+A+YPI+++P+l peeYk++Q inragi qe+iqP+g+k
  NP_001138902.1  3 RLFRTLVIFGGFAAVVGAAFYPIYFRPLLLPEEYKREQSINRAGIVQENIQPPGLK 58
                    7889**************************************************97 PP



Or compare NP_001138902.1 to CDD or PaperBLAST