PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001138905.1 to PF15061 (DUF4538)

NP_001138905.1 has 69 amino acids

Query:       DUF4538  [M=57]
Accession:   PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.7e-31   94.1   0.1    1.9e-31   93.9   0.1    1.0  1  NP_001138905.1  


Domain annotation for each sequence (and alignments):
>> NP_001138905.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.9   0.1   1.9e-31   1.9e-31       1      57 []       4      60 ..       4      60 .. 0.98

  Alignments for each domain:
  == domain 1  score: 93.9 bits;  conditional E-value: 1.9e-31
         DUF4538  1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
                    +r+l++al++gGf++++g+A+YPI+++P+++ eeY+k+Q++nragi qe++qP+g+k
  NP_001138905.1  4 ARNLRTALIFGGFISMVGAAFYPIYFRPLMRLEEYQKEQAVNRAGIVQEDVQPPGLK 60
                    69*****************************************************97 PP



Or compare NP_001138905.1 to CDD or PaperBLAST