NP_001138905.1 has 69 amino acids
Query: DUF4538 [M=57] Accession: PF15061.11 Description: Domain of unknown function (DUF4538) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-31 94.1 0.1 1.9e-31 93.9 0.1 1.0 1 NP_001138905.1 Domain annotation for each sequence (and alignments): >> NP_001138905.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.9 0.1 1.9e-31 1.9e-31 1 57 [] 4 60 .. 4 60 .. 0.98 Alignments for each domain: == domain 1 score: 93.9 bits; conditional E-value: 1.9e-31 DUF4538 1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57 +r+l++al++gGf++++g+A+YPI+++P+++ eeY+k+Q++nragi qe++qP+g+k NP_001138905.1 4 ARNLRTALIFGGFISMVGAAFYPIYFRPLMRLEEYQKEQAVNRAGIVQEDVQPPGLK 60 69*****************************************************97 PP
Or compare NP_001138905.1 to CDD or PaperBLAST