PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001143007.1 to PF14364 (DUF4408)

NP_001143007.1 has 232 amino acids

Query:       DUF4408  [M=33]
Accession:   PF14364.11
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.6e-12   31.0   2.6    1.2e-11   30.5   2.6    1.2  1  NP_001143007.1  


Domain annotation for each sequence (and alignments):
>> NP_001143007.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.5   2.6   1.2e-11   1.2e-11       1      31 [.      46      76 ..      46      77 .. 0.96

  Alignments for each domain:
  == domain 1  score: 30.5 bits;  conditional E-value: 1.2e-11
         DUF4408  1 PslwsslrswltPpyLFvvlNvIIitIaasS 31
                    P++w+ +r +l PpyLFv +++II++I+  S
  NP_001143007.1 46 PRVWAAARLCLVPPYLFVTVHLIILVIWKLS 76
                    99**************************998 PP



Or compare NP_001143007.1 to CDD or PaperBLAST