PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001165420.1 to PF10241 (KxDL)

NP_001165420.1 has 176 amino acids

Query:       KxDL  [M=86]
Accession:   PF10241.13
Description: Uncharacterized conserved protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.5e-34  103.8   1.9    3.2e-34  103.4   1.9    1.1  1  NP_001165420.1  


Domain annotation for each sequence (and alignments):
>> NP_001165420.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  103.4   1.9   3.2e-34   3.2e-34       1      86 []      14      99 ..      14      99 .. 0.98

  Alignments for each domain:
  == domain 1  score: 103.4 bits;  conditional E-value: 3.2e-34
            KxDL  1 rlssavdsedldeilalQaqtsgrlnkknreLlelnalsqerlaklrarfkqgtkllkevkkdLesifkkirslkaklakkyPeeY 86
                    r+ s+v+++d+++i+ +Q+++++r++k+n++Ll++n+ls++rl+++++rf ++t++l e+k+dL+sif++ir+lk kla+++Pe++
  NP_001165420.1 14 RILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAF 99
                    5789********************************************************************************98 PP



Or compare NP_001165420.1 to CDD or PaperBLAST