NP_001165908.1 has 784 amino acids
Query: DUF4939 [M=112]
Accession: PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.7e-20 58.2 0.0 7.1e-20 57.3 0.0 1.4 1 NP_001165908.1
Domain annotation for each sequence (and alignments):
>> NP_001165908.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.3 0.0 7.1e-20 7.1e-20 21 103 .. 152 234 .. 134 241 .. 0.94
Alignments for each domain:
== domain 1 score: 57.3 bits; conditional E-value: 7.1e-20
DUF4939 21 wrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeef 103
++p pe+fdG+ + l f+ q +m + fs d+++v f+ ++++Gra +w+ +++ +l+ ny af+ emk++f
NP_001165908.1 152 EECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVF 234
579999***************************************************************************99 PP
Or compare NP_001165908.1 to CDD or PaperBLAST