PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001165908.1 to PF16297 (DUF4939)

NP_001165908.1 has 784 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.7e-20   58.2   0.0    7.1e-20   57.3   0.0    1.4  1  NP_001165908.1  


Domain annotation for each sequence (and alignments):
>> NP_001165908.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.3   0.0   7.1e-20   7.1e-20      21     103 ..     152     234 ..     134     241 .. 0.94

  Alignments for each domain:
  == domain 1  score: 57.3 bits;  conditional E-value: 7.1e-20
         DUF4939  21 wrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeef 103
                      ++p   pe+fdG+ + l  f+ q   +m    + fs d+++v f+ ++++Gra +w+   +++  +l+ ny af+ emk++f
  NP_001165908.1 152 EECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVF 234
                     579999***************************************************************************99 PP



Or compare NP_001165908.1 to CDD or PaperBLAST