PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001191012.1 to PF04418 (DUF543)

NP_001191012.1 has 140 amino acids

Query:       DUF543  [M=75]
Accession:   PF04418.16
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.3e-29   88.3   0.5    1.8e-29   87.8   0.5    1.2  1  NP_001191012.1  


Domain annotation for each sequence (and alignments):
>> NP_001191012.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.8   0.5   1.8e-29   1.8e-29      14      74 ..       2      62 ..       1      63 [. 0.97

  Alignments for each domain:
  == domain 1  score: 87.8 bits;  conditional E-value: 1.8e-29
          DUF543 14 sesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasF 74
                    ses+l +kwD+cL++++vk+g G+g G+v+s+ +f+rR++p ++G G+GlG+aY++c+ +F
  NP_001191012.1  2 SESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDF 62
                    5799*******************************************************99 PP



Or compare NP_001191012.1 to CDD or PaperBLAST